PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41088.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 220aa    MW: 24900.1 Da    PI: 8.6925
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41088.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-171360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l+d+++ +G g+W++I++  g++R++k+c+ rw++yl
       KHN41088.1 13 KGAWSKQEDQKLIDYIQVHGEGCWRSIPKAAGLHRCGKSCRMRWLNYL 60
                     79********************************************97 PP

2Myb_DNA-binding49.11.3e-1567110247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g + ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++
       KHN41088.1  67 GIFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 110
                      66779****************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-24462IPR009057Homeodomain-like
PROSITE profilePS5129425.579864IPR017930Myb domain
SuperFamilySSF466893.15E-2910107IPR009057Homeodomain-like
SMARTSM007179.7E-151262IPR001005SANT/Myb domain
PfamPF002496.4E-161360IPR001005SANT/Myb domain
CDDcd001672.39E-111560No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2463116IPR009057Homeodomain-like
PROSITE profilePS5129420.51465115IPR017930Myb domain
SMARTSM007172.4E-1465113IPR001005SANT/Myb domain
PfamPF002495.3E-1469110IPR001005SANT/Myb domain
CDDcd001677.21E-1171111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MRKPCCDKEN INKGAWSKQE DQKLIDYIQV HGEGCWRSIP KAAGLHRCGK SCRMRWLNYL  60
RPGIKRGIFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH IRRKLIKMGI  120
DPNSHKPHQS FPRPHVSSAD HQGASTSESI NNNKVPFFNS RGSAATDHHK ISFTKEETSI  180
ISSPPLNLDL TISLPSPVEE NKNSDHESAK TCDVDIDLNC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-291111525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0904650.0BT090465.1 Soybean clone JCVI-FLGm-4F17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238116.11e-164uncharacterized protein LOC100306391
SwissprotQ9SZP12e-78MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A0B2S8M91e-164A0A0B2S8M9_GLYSO; Transcription repressor MYB4-like protein
TrEMBLC6SZ671e-164C6SZ67_SOYBN; Uncharacterized protein
STRINGGLYMA02G41440.11e-164(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.19e-80myb domain protein 4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]